PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P03450_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 243aa    MW: 27969.5 Da    PI: 8.3255
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P03450_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181663148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT++Ed+ll++ v+++G g+W+++++  g++R++k+c++rw +yl
  GSMUA_Achr1P03450_001 16 KGPWTAQEDKLLIEHVNLHGEGRWNSVSELSGLRRSGKSCRLRWVNYL 63
                           79********************************************97 PP

2Myb_DNA-binding53.46e-1769113147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            +g+ T+eE+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  GSMUA_Achr1P03450_001  69 KGKITPEEENVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 113
                            6899******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.11163IPR017930Myb domain
SuperFamilySSF466894.87E-3014110IPR009057Homeodomain-like
SMARTSM007174.6E-161565IPR001005SANT/Myb domain
PfamPF002492.3E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-231770IPR009057Homeodomain-like
CDDcd001671.65E-111863No hitNo description
PROSITE profilePS5129425.86864118IPR017930Myb domain
SMARTSM007176.2E-1668116IPR001005SANT/Myb domain
PfamPF002497.9E-1569113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-2571117IPR009057Homeodomain-like
CDDcd001675.28E-1173114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MERYFEAVAV ADGWRKGPWT AQEDKLLIEH VNLHGEGRWN SVSELSGLRR SGKSCRLRWV  60
NYLRPDLKKG KITPEEENVI LELHALWGNR WSTIARSLPG RTDNEIKNYW RTHFKKSTPS  120
KNIEKARARF LRRRQQQQQH QAVPPPPPPP QQQQDDMRTI MNQVAQITLA QDMQQEMAYM  180
YPLPYALQQQ GGAAHGCVVD GPAAAAAEDD SWGSLWNLDD VQHDVERVCR GCLQVQDQAL  240
SFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261611827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009390081.10.0PREDICTED: transcription factor MYB21-like
TrEMBLM0RWQ30.0M0RWQ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P03450_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-68myb domain protein 305